Description

  • Product name

    Recombinant Human NR0B2 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLC APHRTCREALDVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGL AQDAVTFEVAEAPVPSILKKILLEEPSSSGGSGQLPDRPQPSLAAVQWLQ CCLESFWSLELSPKEYACLKGTILFNPDVPGLQAASHIGHLQQEAHWVLC EVLEPWCPAAQGRLTRVLLTASTLKSIPTSLLGDLFFRPIIGDVDIAGLL GDMLLLR
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      1 to 257

Specifications

Our Abpromise guarantee covers the use of ab132488 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • NR0B2
    • NR0B2_HUMAN
    • Nr0b2a
    • Nuclear receptor subfamily 0 group B member 2
    • Nuclear receptor subfamily 0, group B, member 2a
    • Orphan nuclear receptor SHP
    • SHP
    • SHP-1
    • Shp1
    • Small heterodimer partner
    see all
  • Function

    Acts as a transcriptional regulator. Acts as a negative regulator of receptor-dependent signaling pathways. Specifically inhibits transactivation of the nuclear receptor with whom it interacts. Inhibits transcriptional activity of NEUROD1 on E-box-containing promoter by interfering with the coactivation function of the p300/CBP-mediated trancription complex for NEUROD1.
  • Tissue specificity

    Liver. Low levels of expression were detected in heart and pancreas.
  • Involvement in disease

    Obesity
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR0 subfamily.
  • Post-translational
    modifications

    Arginine methylation by PRMT5 enhances repression activity of metabolic genes in liver in response to bile acid signaling, by increasing interaction with cofactors.
  • Cellular localization

    Nucleus. Cytoplasm. Colocalizes with NEUROD1 in the nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132488 stained with Coomassie Blue

References

ab132488 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132488.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up