Overview

  • Product name

    Recombinant Human NRAMP1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MTGDKGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLRNIESDLQAGA VAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKVPRTV LWLTIELAIVGSDMQEVIGTAIAFNLLSAGRYHPSVPQLFRPGREQLLLL PPLTSPSQSLFYPAVPSEAGLLPCFPEM
    • Amino acids

      1 to 178
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159530 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • LSH
    • Natural resistance associated macrophage protein 1
    • Natural resistance-associated macrophage protein 1
    • NRAM1_HUMAN
    • NRAMP
    • NRAMP 1
    • PBC
    • SLC11A1
    • Solute carrier family 11 (proton coupled divalent metal ion transporters) member 1
    • solute carrier family 11 (sodium/phosphate symporters) member 1
    • Solute carrier family 11 member 1
    see all
  • Function

    Divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Macrophage-specific membrane transport function. Controls natural resistance to infection with intracellular parasites. Pathogen resistance involves sequestration of Fe(2+) and Mn(2+), cofactors of both prokaryotic and eukaryotic catalases and superoxide dismutases, not only to protect the macrophage against its own generation of reactive oxygen species, but to deny the cations to the pathogen for synthesis of its protective enzymes.
  • Tissue specificity

    Macrophages; peripheral blood leukocytes, lung, spleen and liver.
  • Sequence similarities

    Belongs to the NRAMP family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab159530 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159530 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159530.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up