Description

  • Product name

    Recombinant Human NrCAM protein
  • Purity

    > 95 % SDS-PAGE.
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QMISALEVPLDPKLLEDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGKP PPSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAETYEGVYQCT ARNERGAAVSNNIVVRPSRSPLWTKEKLEPITLQSGQSLVLPCRPPIGLP PPIIFWMDNSFQRLPQSERVSQGLNGDLYFSNVLPEDTREDYICYARFNH TQTIQQKQPISVKVISAKSSRERPPTFLTPEGNASNKEELRGNVLSLECI AEGLPTPIIYWAKEDGMLPKNRTVYKNFEKTLQIIHVSEADSGNYQCIAK NALGAIHHTISVRVKAAPYWITAPQNLVLSPGEDGTLICRANGNPKPRIS WLTNGVPIEIAPDDPSRKIDGDTIIFSNVQERSSAVYQCNASNEYGYLLA NAFVNVLAEPPRILTPANTLYQVIANRPALLDCAFFGSPLPTIEWFKGAK GSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIK DATWIVKQPEYAVVQRGSMVSFECKVKHDHTLSLTVLWLKDNRELPSDER FTVDKDHLVVADVSDDDSGTYTCVANVDDIEGRMDEPKSCDKTHTCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK
    • Predicted molecular weight

      91 kDa including tags
    • Amino acids

      25 to 600
    • Additional sequence information

      Fused with a FC tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab191986 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution.

  • Reconstitution
    Dissolve protein in 1 x PBS to a concentration no less than 100ug/ml.

General Info

  • Alternative names

    • Bravo
    • hBravo
    • Neuronal cell adhesion molecule
    • Neuronal surface protein Bravo
    • Ng CAM related
    • Ng-CAM-related
    • NgCAM related cell adhesion molecule
    • NgCAM-related cell adhesion molecule
    • Nr CAM
    • Nr-CAM
    • Nrcam
    • NRCAM_HUMAN
    see all
  • Function

    Cell adhesion, ankyrin-binding protein involved in neuron-neuron adhesion. May play a role in the molecular assembly of the nodes of Ranvier.
  • Tissue specificity

    Detected in all the examined tissues. In the brain it was detected in the amygdala, caudate nucleus, corpus callosum, hippocampus, hypothalamus, substantia nigra, subthalamic nucleus and thalamus.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. L1/neurofascin/NgCAM family.
    Contains 5 fibronectin type-III domains.
    Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab191986 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191986.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up