Overview

  • Product name

    Recombinant Human NRF1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPED TSYDDSDILNSTAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESN PSIRKRQQTRLLRKLRATLDEYTTRVGQQAIVLCISPSKPNPVFKVFGAA PLENVVRKYKSMILEDLESALAEHAPAPQEVNSELPPLTIDGIPVSVDKM TQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTE EQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQTQATATHSIAHL VPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSA VADGEVEQNWATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGA TVTMALNSEAAAHAVATLAEATLQGGGQIVLSGETAAAVGALTGVQDANG LFMADRAGRKWILTDKATGLVQIPVSMYQTVVTSLAQGNGPVQVAMAPVT TRISDSAVTMDGQAVEVVTLEQ
    • Molecular weight

      82 kDa including tags
    • Amino acids

      1 to 522

Specifications

Our Abpromise guarantee covers the use of ab132404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • alpha pal
    • alpha palindromic binding protein
    • Alpha palindromic-binding protein
    • Alpha-pal
    • locus control region factor 1
    • NFE2 related factor 1
    • NRF-1
    • Nrf1
    • NRF1_HUMAN
    • Nuclear respiratory factor 1
    see all
  • Function

    Transcription factor that activates the expression of the EIF2S1 (EIF2-alpha) gene. Links the transcriptional modulation of key metabolic genes to cellular growth and development. Implicated in the control of nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication.
  • Tissue specificity

    Ubiquitously expressed with strongest expression in skeletal muscle.
  • Sequence similarities

    Belongs to the NRF1/Ewg family.
  • Post-translational
    modifications

    Phosphorylation enhances DNA binding.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132404 stained with Coomassie Blue.

References

ab132404 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132404.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up