Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEK QKKLEKERQEQLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSA NYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGH IESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCL NIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVGNCSPHFLNAF EDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMP SPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNT SPSVASPEHSVESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSS GDMVQPLSPSQGQSTHVHDAQCENTPEKELPVSPGHRKTPFTKDKHSSRL EAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRD IRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSL HLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKP DVKKN
    • Molecular weight

      94 kDa including tags
    • Amino acids

      1 to 605

Specifications

Our Abpromise guarantee covers the use of ab132356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • erythroid derived 2
    • HEBP1
    • like 2
    • NF E2 related factor 2
    • NF-E2-related factor 2
    • NF2L2_HUMAN
    • NFE2 related factor 2
    • NFE2-related factor 2
    • Nfe2l2
    • Nrf 2
    • NRF2
    • Nuclear factor
    • Nuclear factor (erythroid derived 2) like 2
    • nuclear factor erythroid 2 like 2
    • Nuclear factor erythroid 2 related factor 2
    • Nuclear factor erythroid 2-related factor 2
    • Nuclear factor erythroid derived 2 like 2
    see all
  • Function

    Transcription activator that binds to antioxidant response (ARE) elements in the promoter regions of target genes. Important for the coordinated up-regulation of genes in response to oxidative stress. May be involved in the transcriptional activation of genes of the beta-globin cluster by mediating enhancer activity of hypersensitive site 2 of the beta-globin locus control region.
  • Tissue specificity

    Widely expressed. Highest expression in adult muscle, kidney, lung, liver and in fetal muscle.
  • Sequence similarities

    Belongs to the bZIP family. CNC subfamily.
    Contains 1 bZIP domain.
  • Domain

    Acidic activation domain in the N-terminus, and DNA binding domain in the C-terminus.
  • Post-translational
    modifications

    Phosphorylation of Ser-40 by PKC in response to oxidative stress dissociates NFE2L2 from its cytoplasmic inhibitor KEAP1, promoting its translocation into the nucleus.
  • Cellular localization

    Cytoplasm > cytosol. Nucleus. Cytosolic under unstressed conditions, translocates into the nucleus upon induction by electrophilic agents.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132356 stained with Coomassie Blue.

References

This product has been referenced in:

  • Rajesh Y  et al. Targeting NFE2L2, a transcription factor upstream of MMP-2: A potential therapeutic strategy for temozolomide resistant glioblastoma. Biochem Pharmacol 164:1-16 (2019). Read more (PubMed: 30885764) »
See 1 Publication for this product

Customer reviews and Q&As

Question
Answer

The Nrf2 protein ab132356 was produced by wheat germ expression, then purified with pull-down of the GST tag using GE's Glutathione Sepharose 4 Fast Flow.

The wheat germ expression system was developed by Professor Yaeta Endo of Ehime University, Japan.
Here is a link to a recent review: http://www.ncbi.nlm.nih.gov/pubmed/20800705 .

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up