Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMMDLELPPPGLPSQQDMDLIDILWRQDIDL GVSREVFDFSQRRKEYELEKQKKLEKERQEQLQKEQEKAFFAQLQLDEET GEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFV DDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGM QQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYS SIPSMEKEVGNCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTD FGDEFYSAFIAEPSISNSMPSPATLSHSLSELLNGPIDVSDLSLCKAFNQ NHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSYGDTLLGLSDSEVEE LDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDAQCENTPEKEL PVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVD FNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLD HLKDEKEKLLKEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSE YSLQQTRDGNVFLVPKSKKPDVKKN
    • Molecular weight

      70 kDa including tags
    • Amino acids

      1 to 605
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_006155.2.

Specifications

Our Abpromise guarantee covers the use of ab202153 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.
    ab202153 was purified by using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • erythroid derived 2
    • HEBP1
    • like 2
    • NF E2 related factor 2
    • NF-E2-related factor 2
    • NF2L2_HUMAN
    • NFE2 related factor 2
    • NFE2-related factor 2
    • Nfe2l2
    • Nrf 2
    • NRF2
    • Nuclear factor
    • Nuclear factor (erythroid derived 2) like 2
    • nuclear factor erythroid 2 like 2
    • Nuclear factor erythroid 2 related factor 2
    • Nuclear factor erythroid 2-related factor 2
    • Nuclear factor erythroid derived 2 like 2
    see all
  • Function

    Transcription activator that binds to antioxidant response (ARE) elements in the promoter regions of target genes. Important for the coordinated up-regulation of genes in response to oxidative stress. May be involved in the transcriptional activation of genes of the beta-globin cluster by mediating enhancer activity of hypersensitive site 2 of the beta-globin locus control region.
  • Tissue specificity

    Widely expressed. Highest expression in adult muscle, kidney, lung, liver and in fetal muscle.
  • Sequence similarities

    Belongs to the bZIP family. CNC subfamily.
    Contains 1 bZIP domain.
  • Domain

    Acidic activation domain in the N-terminus, and DNA binding domain in the C-terminus.
  • Post-translational
    modifications

    Phosphorylation of Ser-40 by PKC in response to oxidative stress dissociates NFE2L2 from its cytoplasmic inhibitor KEAP1, promoting its translocation into the nucleus.
  • Cellular localization

    Cytoplasm > cytosol. Nucleus. Cytosolic under unstressed conditions, translocates into the nucleus upon induction by electrophilic agents.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202153 (3µg).

References

This product has been referenced in:

  • Abu-Bakar A  et al. Cyp2a5 Promoter-based Gene Reporter Assay: A Novel Design of Cell-based Bioassay for Toxicity Prediction. Basic Clin Pharmacol Toxicol 123 Suppl 5:72-80 (2018). Read more (PubMed: 29788535) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202153.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up