Overview

  • Product name

    Recombinant Human NRIP protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLSRWFEEASEVAQSNRGRGRSRPRGGTSQSDISTLPTVPSSPDLEVSET AMEVDTPAEQFLQPSTSSTMSAQAHSTSSPTESPHSTPLLSSPDSEQRQS VEASGHHTHHQSDNNNEKLSPKPGTGEPVLSLHYSTEGTTTSTIKLNFTD EWSSIASSSRGIGSHCKSEGQEESFVPQSSVQPPEGDSETKAPEESSEDA TKYQEGVSAENPVENHINITQSDKFTAKPLDSNSGERNDLNLDRSCGVPE ESASSEKAKEPETSDQTSTESATNENNTNPEPQFQTEATGPSAHEETSTR DSALQDTDDSDDDPVLIPGARYRAGPGDRRSAVARIQEFFRRRKERKEME ELDTLNIRRPLVKMVYKGHRNSRTMIKEANFWGANFVMSGSDCGHIFIWD RHTAEHLMLLEADNHVVNCLQPHPFDPILASSGIDYDIKIWSPLEESRIF NRKLADEVITRNELMLEETRNTITVPASFMLRMLASLNHIRADRLEGDRS EGSGQENENEDEE
    • Molecular weight

      83 kDa including tags
    • Amino acids

      348 to 860

Specifications

Our Abpromise guarantee covers the use of ab132515 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1200006M05Rik
    • Androgen receptor complex associated protein
    • Androgen receptor complex-associated protein
    • ARCAP
    • DCAF6
    • DCAF6_HUMAN
    • DDB1 and CUL4 associated factor 6
    • DDB1- and CUL4-associated factor 6
    • IQ motif and WD repeat-containing protein 1
    • IQ motif and WD repeats 1
    • IQWD1
    • MSTP055
    • NRIP
    • Nuclear receptor interaction protein
    • RP4 745I14.1
    see all
  • Function

    Ligand-dependent coactivator of nuclear receptors. Enhance transcriptional activity of the nuclear receptors NR3C1 and AR. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.
  • Tissue specificity

    Highly expressed in skeletal muscle and testis. Expressed to a lesser degree in heart, prostate, and adrenal gland.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 IQ domain.
    Contains 7 WD repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132515 stained with Coomassie Blue.

References

ab132515 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132515.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up