Description

  • Product name

    Recombinant Human NRN1L protein
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AAGPNRCDTIYQGFAECLIRLGDSMGRGGELETICRSWNDFHACASQVLS GCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQETL RATAVDHHHHHH
    • Predicted molecular weight

      12 kDa including tags
    • Amino acids

      36 to 139
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included. The propeptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab194015 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

  • Reconstitution
    Reconstituted protein solution can be stored at 4-7 deg.C for 2-7 days. Aliquots of reconstituted samples are stable at < -20 deg.C for 3 months.

General Info

  • Alternative names

    • MRCC2446
    • Neuritin-like protein
    • Nrn1l
    • NRN1L_HUMAN
    • UNQ2446/PRO5725
    see all
  • Sequence similarities

    Belongs to the neuritin family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab194015 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194015.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up