Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTAVGRRCPALGSRGAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEE LKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCR WRNQALHFKI
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160778 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cas/HEF1 associated signal transducer
    • CHAT
    • FLJ39664
    • Novel SH2 containing protein 3
    • Novel SH2-containing protein 3
    • NSP 3
    • PRO34088
    • SH2 domain containing 3C
    • SH2 domain containing Eph receptor binding protein 1
    • SH2 domain containing protein 3C
    • SH2 domain-containing protein 3C
    • SH2D3_HUMAN
    • SH2D3C
    • Shep1
    see all
  • Function
    Eph receptor-binding protein which may be a positive regulator of TCR signaling. Binding to BCAR1 is required to induce membrane ruffling and promote EGF-dependent cell migration.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Contains 1 Ras-GEF domain.
    Contains 1 SH2 domain.
  • Cellular localization
    Cytoplasm. Membrane. Associated with the membrane when EGF-stimulated. Found at ruffling membranes.
  • Information by UniProt

Images

  • ab160778 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160778 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160778.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up