Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWI VTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIK ELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLR TMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMH RDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCSAEALPVGRGRV GLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL
    • Molecular weight
      33 kDa
    • Amino acids
      1 to 284

Associated products

Specifications

Our Abpromise guarantee covers the use of ab172827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituent: 100% PBS

General Info

  • Alternative names
    • BR STL 1
    • Brain sulfotransferase like protein
    • Brain sulfotransferase-like protein
    • Brain sulphotransferase like
    • BRSTL1
    • DJ388M5.3
    • hBR STL
    • hBR STL 1
    • hBR-STL
    • hBR-STL-1
    • MGC40032
    • Nervous system cytosolic sulfotransferase
    • Nervous system sulfotransferase
    • NST
    • OTTHUMP00000028875
    • ST4A1
    • ST4A1_HUMAN
    • Sulfotransferase 4A1
    • Sulfotransferase family 4A member 1
    • Sulfotransferase related protein
    • SULT4A1
    • SULTX3
    see all
  • Function
    Atypical sulfotransferase family member with very low affinity for 3'-phospho-5'-adenylyl sulfate (PAPS) and very low catalytic activity towards L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphthylamine, and 2-beta-naphthol. May have a role in the metabolism of drugs and neurotransmitters in the CNS.
  • Tissue specificity
    Highly expressed in the cerebral cortex and frontal lobe, slightly less in the cerebellum, occipital and temporal lobes, relatively low in the medulla and putamen, and lowest in the spinal cord. No expression detected in the pancreas (PubMed:10698717). Highly expressed in fetal brain and occipital lobe, slightly less in the whole brain, frontal lobe, hippocampus, and lung, very low expression in cerebellum, medulla oblongata, temporal lobe, testis, kidney and appendix (PubMed:12039030).
  • Sequence similarities
    Belongs to the sulfotransferase 1 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab172827 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172827.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up