Overview

  • Product name

    Recombinant Human NSUN5 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGLYAAAAGVLAGVESRQGSIKGLVYSSNFQNVKQLYALVCETQRYSAVL DAVIASAGLLRAEKKLRPHLAKVLVYELLLGKGFRGGGGRWKALLGRHQA RLKAELARLKVHRGVSRNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDV VDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEH PLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKN QGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVH YILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPS LQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPG AEHCLRASPETTLSSGFFVAVIERVEVPR
    • Amino acids

      1 to 429
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163181 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ10267
    • MGC986
    • NOL1
    • NOL1-related protein
    • NOL1/NOP2/Sun domain family member 5
    • NOL1R
    • NOP2/Sun domain family, member 5
    • NOP2/Sun domain family, member 5A
    • NSUN5
    • NSUN5_HUMAN
    • p120
    • Putative methyltransferase NSUN5
    • WBSCR20
    • WBSCR20A
    • Williams Beuren syndrome chromosome region 20A
    • Williams-Beuren syndrome chromosomal region 20A protein
    • Williams-Beuren syndrome critical region protein 20 copy A
    see all
  • Function

    May have S-adenosyl-L-methionine-dependent methyl-transferase activity.
  • Tissue specificity

    Ubiquitous. Detected in placenta, heart and skeletal muscle.
  • Involvement in disease

    Note=NSUN5 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.
  • Sequence similarities

    Belongs to the methyltransferase superfamily. RsmB/NOP family.
  • Post-translational
    modifications

    Isoform 2 is phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

Images

  • ab163181 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163181 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163181.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up