Overview

  • Product name
    Recombinant Human NT2NL protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKAT CRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTG KECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIP GHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQT GDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN
    • Amino acids
      1 to 236
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166418 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • N2N
    • Notch 2 N terminal like
    • Notch homolog 2 (Drosophila) N-terminal like
    • Notch homolog 2 N-terminal-like protein
    • NOTCH2NL
    • NT2NL_HUMAN
    • OTTHUMP00000015593
    see all
  • Function
    May function in the Notch signaling pathway and regulate neutrophil differentiation.
  • Tissue specificity
    Widely expressed with higher levels in leukocytes and lymph nodes.
  • Sequence similarities
    Belongs to the NOTCH family.
    Contains 6 EGF-like domains.
  • Post-translational
    modifications
    Cleaved by ELANE.
  • Cellular localization
    Secreted. Cytoplasm.
  • Information by UniProt

Images

  • ab166418 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166418 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166418.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up