Description

  • Product name

    Recombinant Human NT5C1A protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEPGQPREPQEPREPGPGAETAAAPVWEEAKIFYDNLAPKKKPKSPKPQN AVTIAVSSRALFRMDEEQQIYTEQGVEEYVRYQLEHENEPFSPGPAFPFV KALEAVNRRLRELYPDSEDVFDIVLMTNNHAQVGVRLINSINHYDLFIER FCMTGGNSPICYLKAYHTNLYLSADAEKVREAIDEGIAAATIFSPSRDVV VSQSQLRVAFDGDAVLFSDESERIVKAHGLDRFFEHEKAHENKPLAQGPL KGFLEALGRLQKKFYSKGLRLECPIRTYLVTARSAASSGARALKTLRSWG LETDEALFLAGAPKGPLLEKIRPHIFFDDQMFHVAGAQEMGTVAAHVPYG VAQTPRRTAPAKQAPSAQ
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      1 to 368
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-tagged

Specifications

Our Abpromise guarantee covers the use of ab241514 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • 5' nucleotidase cytosolic IA
    • 5NT1A_HUMAN
    • AMP specific 5' NT
    • CN I
    • CN IA
    • cN-I
    • cN-IA
    • CN1
    • cN1A
    • cNI
    • cNIA
    • Cytosolic 5' nucleotidase 1A
    • Cytosolic 5' nucleotidase IA
    • Cytosolic 5' nucleotidase type 1A
    • Cytosolic 5''-nucleotidase 1A
    • Cytosolic 5''-nucleotidase IA
    • MGC119199
    • MGC119201
    • NT5C1A
    • nucleotidase, 5-prime, cytosolic, IA
    see all
  • Function

    Dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides and has a broad substrate specificity. Helps to regulate adenosine levels in heart during ischemia and hypoxia.
  • Tissue specificity

    Highly expressed in skeletal muscle. Detected at intermediate levels in heart, brain, kidney and pancreas.
  • Sequence similarities

    Belongs to the 5'-nucleotidase type 3 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel ab241514.

References

ab241514 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab241514.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up