Overview

  • Product name

    Recombinant Human NT5C/dNT-1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQY RALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDPLLKYHHC VGEKVWLPRPYSARGAA
    • Amino acids

      1 to 117
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162324 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as NT5C.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 3''-pyrimidine nucleotidase
    • 5' nucleotidase, deoxy (pyrimidine)
    • 5' nucleotidase, deoxy (pyrimidine), cytosolic type C
    • 5''(3'')-deoxyribonucleotidase
    • 5'(3')-deoxyribonucleotidase, cytosolic type
    • 5', 3'-nucleotidase, cytosolic
    • 5-prime,3-prime-nucleotidase, cytosolic
    • cdN
    • Cytosolic 5''
    • cytosolic 5',3'-pyrimidine nucleotidase
    • cytosolic type
    • cytosolic type C,5',3'-nucleotidase
    • cytosolic,uridine 5'-monophosphate phosphohydrolase 2
    • Deoxy 5' nucleotidase 1
    • Deoxy-5''-nucleotidase 1
    • Deoxyribonucleotidase, cytosolic, 1
    • DNT
    • dNT-1
    • dNT1
    • Nt5c
    • NT5C_HUMAN
    • P5N2
    • PN-I
    • PN-II
    • Pyrimidine 5-prime nucleotidase 2
    • UMPH2
    • uridine 5'-monophosphate phosphohydrolase 2
    • uridine 5-prime monophosphate hydrolase 2
    see all
  • Function

    Dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides, with a preference for dUMP and dTMP, intermediate activity towards dGMP, and low activity towards dCMP and dAMP.
  • Tissue specificity

    Detected in skeletal muscle, heart and pancreas.
  • Sequence similarities

    Belongs to the 5'(3')-deoxyribonucleotidase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab162324 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162324 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162324.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up