Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSSGTELLWPGAALLVLLGVAASLCVRCSRPGAKRSEKIYQQRSLREDQQ SFTGSRTYSLVGQAWPGPLADMAPTRKDKLLQFYPSLEDPASSRYQNFSK GSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVLICKQKTTETG AQQEGIGGLCRGDLSLSLALKTGPTSGLCPSASPEEDEESEDYQNSASIH QWRESRKVMGQLQREASPGPVGSPDEEDGEPDYVNGEVAATEA
    • Molecular weight

      53 kDa including tags
    • Amino acids

      1 to 243

Specifications

Our Abpromise guarantee covers the use of ab131939 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HSPC046
    • LAB
    • LAT2
    • Linker for activation of B cells
    • Linker for activation of B-cells
    • Linker for activation of T cells family member 2
    • Linker for activation of T cells transmembrane adaptor 2
    • Linker for activation of T-cells family member 2
    • Membrane associated adapter molecule
    • Membrane-associated adapter molecule
    • Non T cell activation linker
    • Non-T-cell activation linker
    • NTAL_HUMAN
    • WBSCR 5
    • Wbscr15
    • Williams Beuren syndrome chromosome region 15
    • Williams Beuren syndrome chromosome region 5
    • Williams-Beuren syndrome chromosomal region 15 protein
    • Williams-Beuren syndrome chromosomal region 5 protein
    • WSCR5
    see all
  • Function

    Involved in FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. May also be involved in BCR (B-cell antigen receptor)-mediated signaling in B-cells and FCGR1 (high affinity immunoglobulin gamma Fc receptor I)-mediated signaling in myeloid cells. Couples activation of these receptors and their associated kinases with distal intracellular events through the recruitment of GRB2.
  • Tissue specificity

    Highly expressed in spleen, peripheral blood lymphocytes, and germinal centers of lymph nodes. Also expressed in placenta, lung, pancreas and small intestine. Present in B-cells, NK cells and monocytes. Absent from T-cells (at protein level).
  • Involvement in disease

    Note=LAT2 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of LAT2 may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease.
  • Post-translational
    modifications

    Phosphorylated on tyrosines following cross-linking of BCR in B-cells, FCGR1 in myeloid cells, or FCER1 in mast cells; which induces the recruitment of GRB2.
    May be polyubiquitinated.
  • Cellular localization

    Cell membrane. Present in lipid rafts.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab131939 at approximately 53 kDa.
    Stained with Coomassie Blue.

References

ab131939 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131939.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up