Overview

  • Product name

    Recombinant Human NUB1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAQKKYLQAKLTQFLREDRIQLWKPPYTDENKKVGLALKDLAKQYSDRLE CCENEVEKVIEEIRCKAIERGTGNDNYRTTGIATIEVFLPPRLKKDRKNL LETRLHITGRELRSKIAETFGLQENYIKIVINKKQLQLGKTLEEQGVAHN VKAMVLELKQSEEDARKNFQLEEEEQNEAKLKEKQIQRTKRGLEILAKRA AETVVDPEMTPYLDIANQTGRSIRIPPSERKALMLAMGYHEKGRAFLKRK EYGIALPCLLDADKYFCECCRELLDTVDNYAVLQLDIVWCYFRLEQLECL DDAEKKLNLAQKCFKNCYGENHQRLVHIKGNCGKEKVLFLRLYLLQGIRN YHSGNDVEAYEYLNKARQLFKELYIDPSKVDNLLQLGFTAQEARLGLRAC DGNVDHAATHITNRREELAQIRKEEKEKKRRRLENIRFLKGMGYSTHAAQ QILLSNPQMWWLNDSNPETDNRQESPSQENIDRLVYMGFDALVAEAALRV FRGNVQLAAQTLAHNGGSLPPELPLSPEDSLSPPATSPSDSAGTSSASTD EDMETEAVNEILEDIPEHEEDYLDSTLEDEEIIIAEYLSYVENRKSATKK N
    • Amino acids

      1 to 601
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162630 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as NYREN18, Nubbin

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BS4
    • NEDD8 ultimate buster 1
    • Negative regulator of ubiquitin like proteins 1
    • Negative regulator of ubiquitin-like proteins 1
    • NUB1
    • NUB1_HUMAN
    • NUB1L
    • NY REN 18
    • NYREN18
    • Renal carcinoma antigen NY-REN-18
    see all
  • Function

    Specific down-regulator of the NEDD8 conjugation system. Recruits NEDD8, UBD, and their conjugates to the proteasome for degradation. Isoform 1 promotes the degradation of NEDD8 more efficiently than isoform 2.
  • Tissue specificity

    Widely expressed with lowest expression in the pancreas for isoform 1 and in leukocytes, liver, prostate and skeletal muscle for isoform 2.
  • Sequence similarities

    Contains 3 UBA domains.
  • Cellular localization

    Nucleus. Predominantly nuclear.
  • Information by UniProt

Images

  • ab162630 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162630 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162630.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up