Description

  • Product name

    Recombinant Human NUBP1 protein
  • Purity

    > 90 % SDS-PAGE.
    ab202610 was purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMEEVPHDCPGADSAQAGRGASCQGCPN QRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAH GLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLG VMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTS DEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVV ENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNC DKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      1 to 320
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_002475

Specifications

Our Abpromise guarantee covers the use of ab202610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 0.02% DTT, 89% PBS

General Info

  • Alternative names

    • MGC130052
    • Cytosolic Fe S cluster assembly factor NUBP1
    • Cytosolic Fe-S cluster assembly factor NUBP1
    • MGC117406
    • MGC130053
    • NBP
    • NBP 1
    • NBP1
    • NBP35
    • nubp1
    • NUBP1_HUMAN
    • Nucleotide binding protein (e.coli MinD like)
    • Nucleotide binding protein 1
    • Nucleotide binding protein 1 (E.coli MinD like)
    • Nucleotide binding protein 1 (MinD homolog, E. coli)
    • Nucleotide-binding protein 1
    see all
  • Function

    Implicated in the regulation of centrosome duplication (By similarity). Component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for maturation of extramitochondrial Fe/S proteins. May bind and transfer 2 labile 4Fe-4S clusters to target apoproteins.
  • Sequence similarities

    Belongs to the Mrp/NBP35 ATP-binding proteins family. NUBP1/NBP35 subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202610 (3μg).

References

ab202610 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202610.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up