Overview

  • Product name

    Recombinant Human Nucleobindin 1 Precursor protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      PLERGAPNKEETPATESPDTGLYYHRYLQEVIDVLETDGHFREKLQAANA EDIKSGKLSRELDFVSHHVRTKLDELERQEVSRPRMLLKAKMDAEQDPNV QVDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFK RYEMLKEHERRRYLESLGEEQRKEAERKLEEQQRRHREHPKVNVPGSQAQ LKEVWEELDGLDPNRFNPKTFFILHDINSDGVLDEQELEALFTKELEKVY DPKNEEDDMREMEEERLRMREHVMKNVDTNQDRLVTLEEFLASTQRKEFG DTGEGWETVEMHPAYTEEELRRFEEELAAREAELNAKAQRLSQETEALGR SQGRLEAQKRELQQAVLHMEQRKQQQQQQQGHKAPAAHPEGQLKFHPDTD DVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL
    • Molecular weight

      73 kDa including tags
    • Amino acids

      28 to 461

Specifications

Our Abpromise guarantee covers the use of ab132326 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CALNUC
    • HGNC:8043
    • NUC
    • NUCB1
    • NUCB1_HUMAN
    • Nucleobindin-1
    see all
  • Function

    Major calcium-binding protein of the Golgi. May have a role in calcium homeostasis.
  • Tissue specificity

    Expressed both in fetal and adult heart, lung, liver, kidney and brain, and in adult skeletal muscle, placenta and pancreas.
  • Sequence similarities

    Belongs to the nucleobindin family.
    Contains 2 EF-hand domains.
  • Domain

    The EF-hand domains are unfolded in the absence of Ca(2+) and fold upon Ca(2+) addition.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Golgi apparatus > cis-Golgi network membrane. Cytoplasm. A small fraction of the protein may be cytoplasmic.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132326 stained with Coomassie Blue.

References

ab132326 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132326.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up