Overview

  • Product name
    Recombinant Human Nucleolar protein 14
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAKAKKVGARRKASGAPAGARGGPAKANSNPFEVKVNRQKFQILGRKTRH DVGLPGVSRARALRKRTQTLLKEYKERDKSNVFRDKRFGEYNSNMSPEEK MMKRFALEQQRHHEKKSIYNLNEDEELTHYGQSLADIEKHNDIVDSDSDA EDRGTLSAELTAAHFGGGGGLLHKKTQQEGEEREKPKSRKELIEELIAKS KQEKRERQAQREDALELTEKLDQDWKEIQTLLSHKTPKSENRDKKEKPKP DAYDMMVRELGFEMKAQPSNRMKTEAELAKEEQEHLRKLEAERLRRMLGK DEDENVKKPKHMSADDLNDGFVLDKDDRRLLSYKDGKMNVEEDVQEEQSK EASDPESNEEEGDSSGGEDTEESDSPDSHLDLESNVESEEENEKPAKEQR QTPGKGLISGKERAGKATRDELPYTFAAPESYEELRSLLLGRSMEEQLLV VERIQKCNHPSLAEGNKAKLEKLFGFLLEYVGDLATDDPPDLTVIDKLVV HLYHLCQMFPESASDAIKFVLRDAMHEMEEMIETKGRAALPGLDVLIYLK ITGLLFPTSDFWHPVVTPALVCLSQLLTKCPILSLQDVVKGLFVCCLFLE YVALSQRFIPELINFLLGILYIATPNKASQGSTLVHPFRALGKNSELLVV SAREDVATWQQSSLSLRWASRLRAPTSTEANHIRLSCLAVGLALLKRCVL MYGSLPSFHAIMGPLQALLTDHLADCSHPQELQELCQSTLTEMESQKQLC RPLTCEKSKPVPLKLFTPRLVSNSRPQVIHLPWPPNYRCEPQHPAKKVIF FRVIML
    • Amino acids
      1 to 806
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160107 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C4orf9
    • chromosome 4 open reading frame 9
    • NOL14
    • NOP 14
    • NOP14
    • NOP14 nucleolar protein homolog (yeast)
    • NOP14_HUMAN
    • Nucleolar complex protein 14
    • Nucleolar protein 14
    • Nucleolar protein 14 homolog
    • RES4 25
    • RES4-25
    • RES425
    • UTP2
    see all
  • Function
    Involved in nucleolar processing of pre-18S ribosomal RNA. Has a role in the nuclear export of 40S pre-ribosomal subunit to the cytoplasm.
  • Sequence similarities
    Belongs to the NOP14 family.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab160107 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160107 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160107.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up