Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQP ATSTPSTGLFSLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLS NTAATPAMANPSGFGLGSSNLTNAISSTVTSSQGTAPTGFVFGPSTTSVA PATTSGGFSFTGGSTAQPSGFNIGSAGNSAQPTAPATLPFTPATPAATTA GATQPAAPTPTATITSTGPSLFASIATAPTSSATTGLSLCTPVTTAGAPT AGTQGFSLKAPGAASGTSTTTSTAATATATTTSSSSTTGFALNLKPLAPA GIPSNTAAAVTAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERH FLQQATQVNAWDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQ KELEDLLSPLEELVKEQSGTIYLQHADEEREKTYKLAENIDAQLKRMAQD LKDIIEHLNTSGAPADTSDPLQQICKILNAHMDSLQWIDQNSALLQRKVE EVTKVCEGRRKEQERSFRITFD
    • Amino acids
      1 to 522
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161728 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 62 kDa nucleoporin
    • DKFZp547L134
    • FLJ20822
    • FLJ43869
    • IBSN
    • MGC841
    • Nuclear pore glycoprotein p62
    • nucleoporin 62kDa
    • Nucleoporin Nup62
    • nucleoporin p62
    • nucleoporin p62KD
    • NUP62
    • NUP62 protein
    • p62
    • SNDI
    see all
  • Relevance
    The nuclear pore complex is a structure that extends across the nuclear envelope and regulates the flow of macromolecules between the cytoplasm and the nucleus. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. Nup 62 is localized to the nuclear pore central plug. This protein associates with the importin alpha/beta complex which is involved in the import of proteins containing nuclear localization signals. There are multiple transcript variants of this gene, however, they encode a single protein isoform. This protein undergoes post-translational modifications. It contains about 10 N-acetylglucosamine side chain sites.
  • Cellular localization
    Nucleus; nuclear pore complex. Cytoplasm; cytoskeleton; spindle pole. Note: Central region of the nuclear pore, within the transporter. During mitotic cell division, it associates with the poles of the mitotic spindle.

Images

  • ab161728 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161728 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161728.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up