Recombinant Human Nucleosome protein (Biotin) (ab216216)

Description

  • Product name

    Recombinant Human Nucleosome protein (Biotin)
    See all Nucleosome proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVY LAAVLEYLTA EILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLG RVTIAQGGVLPNIQAVLLPKKT ESHHKAKGK
    • Amino acids

      2 to 130
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (NM_033445)
    • Amino Acid Sequence 2

    • Species

      Human
    • Sequence

      PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHP DTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRL LLPGELAKHAVSEGTKAVTKYTSSK
    • Amino acids

      2 to 126
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (NM_003528). Contains a C-terminal Cys added as a biotinylation site.
    • Amino Acid Sequence 3

    • Species

      Human
    • Sequence

      ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYL VGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
    • Amino acids

      2 to 136
    • Tags

      His tag N-Terminus
    • Additional sequence information

      ( NM_003532)
    • Amino Acid Sequence 4

    • Species

      Human
    • Sequence

      SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLI YEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGF GG
    • Amino acids

      2 to 103
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (NM_003548). Total histone MW (before biotinylation) =113.8 kDa.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab216216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Storing  diluted  protein  is not  recommended,  if  necessary,  use  carrier protein (BSA 0.1 – 0.5%).

    ab216216 is Human recombinant nucleosomes consisting of 147 bp DNA (PCR) and 2 molecules each of histones H2A, H2B, H3 and H4. Each histone protein has an N-terminal His-tag. Each H2B has a C-terminal Cys added as a biotinylation site. Total histone MW (before biotinylation) = 113.8 kDa

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.50
    Constituents: 0.32% Tris HCl, 0.02% DTT, 0.03% EDTA, 20% Glycerol

Images

  • SDS-PAGE analysis of ab216216.

  • SDS-PAGE analysis of ab216216.

References

ab216216 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216216.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up