Description

  • Product name

    Recombinant Human NUDC protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGM AEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETS GPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEG EDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVV DIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINK MEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMG LPTSDEQKKQEILKKFMDQHPEMDFSKAKFN
    • Amino acids

      1 to 331
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HNUDC
    • MNUDC
    • MNUDC protein
    • NPD011
    • Nuclear distribution C homolog
    • Nuclear distribution gene C (A.nidulans) homolog
    • Nuclear distribution gene C homolog
    • Nuclear distribution gene C homolog (A. nidulans)
    • Nuclear distribution protein C homolog
    • Nuclear migration protein nudC
    • nudC
    • NudC nuclear distribution protein
    • NUDC_HUMAN
    • OTTHUMP00000004405
    • SIG 92
    • SIG92
    see all
  • Function

    Plays a role in neurogenesis and neuronal migration (By similarity). Necessary for correct formation of mitotic spindles and chromosome separation during mitosis. Necessary for cytokinesis and cell proliferation.
  • Tissue specificity

    Ubiquitous. Highly expressed in fetal liver, kidney, lung and brain. Highly expressed in adult pancreas, kidney, skeletal muscle, liver, lung, placenta, prostate, brain and heart.
  • Sequence similarities

    Belongs to the nudC family.
    Contains 1 CS domain.
  • Post-translational
    modifications

    Reversibly phosphorylated on serine residues during the M phase of the cell cycle. Phosphorylation on Ser-274 and Ser-326 is necessary for correct formation of mitotic spindles and chromosome separation during mitosis. Phosphorylated by PLK and other kinases.
  • Cellular localization

    Cytoplasm > cytoskeleton. Nucleus. In a filamentous pattern adjacent to the nucleus of migrating cerebellar granule cells. Colocalizes with tubulin and dynein and with the microtubule organizing center. Distributed throughout the cytoplasm of non-migrating cells. A small proportion is nuclear, in a punctate pattern.
  • Information by UniProt

Images

  • ab153119 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153119 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153119.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up