Overview

  • Product name
    Recombinant Human NUDCD3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAHGSQEAEAPGAVAGAAEVPREPPILPRIQEQFQKNPDSYNGAVRENYT WSQDYTDLEVRVPVPKHVVKGKQVSVALSSSSIRVAMLEENGERVLMEGK LTHKINTESSLWSLEPGKCVLVNLSKVGEYWWNAILEGEEPIDIDKINKE RSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWDAEGSP FRGQRFDPAMFNISPGAVQF
    • Amino acids
      142 to 361
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161617 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA1068
    • NudC domain containing 3
    • NudC domain containing protein 3
    • NudC like protein
    • NUDCD 3
    • NudCL
    • OTTHUMP00000159457
    see all
  • Relevance
    NUDCD3 functions to maintain the stability of dynein intermediate chain. Depletion of NUDCD3 results in aggregation and degradation of dynein intermediate chain, mislocalization of the dynein complex from kinetochores, spindle microtubules, and spindle poles, and loss of gamma-tubulin from spindle poles. NUDCD3 levels increase after the G1/S transition.

Images

  • ab161617 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161617 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161617.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up