Description

  • Product name

    Recombinant Human NUDT10 protein
  • Purity

    > 95 % SDS-PAGE.
    ab106890 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGG GMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVLTV TELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPT NGNSMAPSSPDSDPLEHHHHHH
    • Predicted molecular weight

      20 kDa including tags
    • Amino acids

      1 to 164
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106890 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • 5'''-P1
    • APS 2
    • APS2
    • Diadenosine 5'
    • Diadenosine 5' 5''' P1 P6 hexaphosphate hydrolase 3 alpha
    • Diadenosine hexaphosphate hydrolase (AMP-forming)
    • Diphosphoinositol polyphosphate phosphohydrolase 3, alpha
    • Diphosphoinositol polyphosphate phosphohydrolase 3-alpha
    • Diphosphoinositol polyphosphate phosphohydrolase type 3 alpha
    • DIPP 3 alpha
    • DIPP 3a
    • DIPP-3-alpha
    • DIPP3 alpha
    • DIPP3-alpha
    • DIPP3a
    • hAps 2
    • hAps2
    • hDIPP3alpha
    • Nucleoside diphosphate linked moiety X motif 10
    • Nucleoside diphosphate-linked moiety X motif 10
    • NUD10_HUMAN
    • Nudix (nucleoside diphosphate linked moiety X) type motif 10
    • Nudix motif 10
    • Nudix type motif 10
    • NUDT 10
    • NUDT10
    • P6-hexaphosphate hydrolase 3-alpha
    see all
  • Function

    Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5-phosphoribose 1-diphosphate.
  • Tissue specificity

    Mainly expressed in testis and, at lower level in brain. According to PubMed:12121577, it is widely expressed.
  • Sequence similarities

    Belongs to the Nudix hydrolase family. DIPP subfamily.
    Contains 1 nudix hydrolase domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab106890.

References

ab106890 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab106890.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up