Recombinant Human NUDT21/CFIM25 protein (ab104669)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
Description
-
Product name
Recombinant Human NUDT21/CFIM25 protein -
Purity
> 90 % SDS-PAGE.
ab104669 is purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMSVVPPNRSQTGWPRGVTQFGNKYIQQTKP LTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTV EGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILG RQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQ EKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN -
Predicted molecular weight
28 kDa including tags -
Amino acids
1 to 227 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab104669 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Additional notes
This product was previously labelled as NUDT21
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
pH: 8.00
Constituents: 0.0308% DTT, 0.316% Tris HCl, 20% Glycerol (glycerin, glycerine), 1.16% Sodium chloride
General Info
-
Alternative names
- CFIM 25
- CFIM25
- Cleavage and polyadenylation specific factor 5
see all -
Function
Component of the cleavage factor Im (CFIm) complex that plays a key role in pre-mRNA 3'-processing. Involved in association with CPSF6 or CPSF7 in pre-MRNA 3'-end poly(A) site cleavage and poly(A) addition. NUDT21/CPSF5 binds to cleavage and polyadenylation RNA substrates. The homodimer mediates simultaneous sequence-specific recognition of two 5'-UGUA-3' elements within the pre-mRNA. Binds to, but does not hydrolyze mono- and di-adenosine nucleotides. May have a role in mRNA export. -
Sequence similarities
Belongs to the Nudix hydrolase family. CPSF5 subfamily.
Contains 1 nudix hydrolase domain. -
Post-translational
modificationsAcetylated mainly by p300/CBP, recruited to the complex by CPSF6. Acetylation decreases interaction with PAPAO. Deacetylated by the class I/II HDACs, HDAC1, HDAC3 and HDAC10, and by the class III HDACs, SIRT1 AND SIRT2. -
Cellular localization
Nucleus. In punctate subnuclear structures localized adjacent to nuclear speckles, called paraspeckles. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab104669 has been referenced in 1 publication.
- Chatrikhi R et al. RNA Binding Protein CELF2 Regulates Signal-Induced Alternative Polyadenylation by Competing with Enhancers of the Polyadenylation Machinery. Cell Rep 28:2795-2806.e3 (2019). PubMed: 31509743