Overview

  • Product name
    Recombinant Human NUDT9 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMNTNVMSGSNGSKENSHNKARTSPYPGSKV ERSQVPNEKVGWLVEWQDYKPVEYTAVSVLAGPRWADPQISESNFSPKFN EKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPII TRWKRDSSGNKIMHPVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISA TLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHLVIYKGYVDDPRNT DNAWMETEAVNYHDETGEIMDNLMLEAGDDAGKVKWVDINDKLKLYASHS QFIKLVAEKRDAHWSEDSEADCHAL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      47 to 350
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107153 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab107153 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • Adenosine diphosphoribose pyrophosphatase
    • ADP ribose diphosphatase
    • ADP ribose phosphohydrolase
    • ADP ribose pyrophosphatase, mitochondrial precursor
    • ADP ribose pyrosphosphatase NUDT9
    • ADP-ribose diphosphatase
    • ADP-ribose phosphohydrolase
    • ADP-ribose pyrophosphatase, mitochondrial
    • ADPR PPase
    • ADPR-PPase
    • EC 3.6.1.13
    • Nucleoside diphosphate linked moiety X motif 9
    • Nucleoside diphosphate linked moiety X type motif 9
    • Nucleoside diphosphate-linked moiety X motif 9
    • Nudix (nucleoside diphosphate linked moiety X) type motif 9
    • Nudix hydrolase 9
    • Nudix motif 9
    • NUDT10
    • NUDT9
    • NUDT9_HUMAN
    see all
  • Function
    Hydrolyzes ADP-ribose (ADPR) to AMP and ribose 5'-phosphate.
  • Tissue specificity
    Ubiquitously expressed but isoform 1 is the most predominant isoform.
  • Sequence similarities
    Belongs to the Nudix hydrolase family. NudF subfamily.
    Contains 1 nudix hydrolase domain.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab107153 (3µg).
    Note: Molecular weight on SDS-PAGE will appear higher.

References

ab107153 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107153.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up