Overview

  • Product name

    Recombinant Human Nuf2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      METLSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPNPKPEVLHMIYM RALQIVYGIRLEHFYMMPVNSEVMYPHLMEGFLPFSNLVTHLDSFLPICR VNDFETADILCPKAKRTSRFLSGIINFIHFREACRETYMEFLWQYKSSAD KMQQLNAAHQEALMKLERLDSVPVEEQEEFKQLSDGIQELQQSLNQDFHQ KTIVLQEGNSQKKSNISEKTKRLNELKLSVVSLKEIQESLKTKIVDSPEK LKNYKEKMKDTVQKLKNARQEVVEKYEIYGDSVDCLPSCQLEVQLYQKKI QDLSDNREKLASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVKKE KLATAQFKINKKHEDVKQYKRTVIEDCNKVQEKRGAVYERVTTINQEIQK IKLGIQQLKDAAEREKLKSQEIFLNLKTALEKYHDGIEKAAEDSYAKIDE KTAELKRKMFKMST
    • Molecular weight

      77 kDa including tags
    • Amino acids

      1 to 464

Specifications

Our Abpromise guarantee covers the use of ab132185 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cancer/testis antigen 106
    • CDCA 1
    • CDCA1
    • Cell division cycle associated 1
    • Cell division cycle associated protein 1
    • Cell division cycle-associated protein 1
    • CT106
    • hNuf 2
    • hNuf2
    • hNuf2R
    • hsNuf2
    • Kinetochore protein Nuf2
    • Nuf 2
    • NUF2
    • NUF2 NDC80 kinetochore complex component
    • NUF2 NDC80 kinetochore complex component homolog
    • NUF2, S. cerevisiae, homolog of
    • NUF2_HUMAN
    • NUF2R
    see all
  • Function

    Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore.
  • Sequence similarities

    Belongs to the NUF2 family.
  • Post-translational
    modifications

    Can be phosphorylated by AURKA and AURKB.
  • Cellular localization

    Nucleus. Chromosome > centromere > kinetochore. Localizes to kinetochores from late prophase to anaphase. Localizes specifically to the outer plate of the kinetochore.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132185 stained with Coomassie Blue.

References

ab132185 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132185.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up