Recombinant Human NUP133 protein (ab163202)

Overview

  • Product name
    Recombinant Human NUP133 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEY LPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQ
    • Amino acids
      1069 to 1155
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163202 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 133 kDa nucleoporin
    • FLJ10814
    • hNUP 133
    • hNUP133
    • MGC21133
    • NU133_HUMAN
    • Nuclear pore complex protein Nup133
    • Nucleoporin 133kDa
    • Nucleoporin NUP133
    • NUP 133
    • NUP133
    • OTTHUMP00000061095
    see all
  • Function
    Involved in poly(A)+ RNA transport.
  • Sequence similarities
    Belongs to the nucleoporin Nup133 family.
  • Cellular localization
    Nucleus > nuclear pore complex. Chromosome > centromere > kinetochore. Located on both the cytoplasmic and nuclear sides of the nuclear pore. During mitosis, localizes to the kinetochores.
  • Information by UniProt

Images

  • ab163202 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163202 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163202.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up