Description

  • Product name

    Recombinant Human NUR77 protein
    See all NUR77 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTAL PSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASAS FKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQ LSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSP SLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPV TSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK YICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLP SKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDA GDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILR LAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDV PAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPAS CLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
    • Predicted molecular weight

      92 kDa including tags
    • Amino acids

      1 to 598

Specifications

Our Abpromise guarantee covers the use of ab114315 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Early response protein NAK1
    • GFRP
    • GFRP 1
    • GFRP1
    • Growth factor inducible nuclear protein N10
    • Growth Factor Inducible Nuclear Protein NP10
    • Growth Factor Response Protein 1
    • Hbr1
    • HMR
    • Hormone Receptor
    • MGC9485
    • N10
    • N10 nuclear protein
    • NAK 1
    • NAK1
    • Nerve growth factor IB nuclear receptor variant 1
    • NGFIB
    • NP 10
    • NP10
    • NR4A1
    • NR4A1_HUMAN
    • Nuclear hormone receptor NUR/77
    • Nuclear Hormone Receptor TR3
    • Nuclear receptor subfamily 4 group A member 1
    • NUR77
    • NUR77, mouse, homolog of
    • Orphan nuclear receptor HMR
    • Orphan nuclear receptor NR4A1
    • Orphan nuclear receptor TR3
    • Orphan receptor tr3
    • Receptor NGFIB
    • ST 59
    • ST-59
    • ST59
    • Steroid receptor TR3
    • Testicular receptor 3
    • TR 3
    • TR3
    • TR3 orphan receptor
    see all
  • Function

    Orphan nuclear receptor. May act concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3' (By similarity). May inhibit NF-kappa-B transactivation of IL2.
  • Tissue specificity

    Fetal muscle and adult liver, brain and thyroid.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR4 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab114315 on a 12.5% gel stained with Coomassie Blue.

References

ab114315 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114315.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up