Description

  • Product name

    Recombinant Human NUSAP protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLG LKGSLKRSAISAAKTGVRFSAATKDNEHKRSLTKTPARKSAHVTVSGGTP KGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLS RPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQR KKREQERKEKKAKVLGMRRGLILAED
    • Amino acids

      1 to 226
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162458 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as NUSAP1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2610201A12Rik
    • AI481307
    • ANKT
    • AW547774
    • BB165529
    • BM037
    • FLJ13421
    • LNP
    • Nucleolar and spindle associated protein 1
    • Nucleolar and spindle-associated protein 1
    • Nucleolar protein ANKT
    • NuSAP
    • NUSAP_HUMAN
    • nusap1
    • PRO0310p1
    • Q0310
    • RP23-22A15.4
    • SAPL
    see all
  • Function

    Microtubule-associated protein with the capacity to bundle and stabilize microtubules (By similarity). May associate with chromosomes and promote the organization of mitotic spindle microtubules around them.
  • Sequence similarities

    Belongs to the NUSAP family.
  • Domain

    The KEN box is required for the FZR1-dependent degradation of this protein subsequent to ubiquitination.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
    Ubiquitinated. Ubiquitination by FZR1 may lead to proteasome-dependent degradation of this protein.
  • Cellular localization

    Cytoplasm. Nucleus > nucleolus. Cytoplasm > cytoskeleton > spindle. Chromosome. Found in the cytoplasm and nucleolus during interphase and redistributes to the mitotic spindle in prometaphase (By similarity). Localizes to the mitotic spindle during anaphase and telophase then disappears from around the chromosomes during cytokinesis (By similarity). Localizes to multiple distinct regions of chromosomes throughout mitosis.
  • Information by UniProt

Images

  • ab162458 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162458 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162458.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up