Description

  • Product name

    Recombinant Human NXF5 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FTGSETLKHLVLQFLQQSNLCKYFKDSRNIKILKDPYLQRKLLKHTKCPR NVDSLSALPETQHDFTSILVDMWYQTVNTCFLPRAGPESQRWWCLLSLKW
    • Amino acids

      271 to 370
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163295 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Nuclear RNA export factor 5
    • TAP like protein 1
    • TAPL 1
    • TAPL1
  • Relevance

    NXF5 is a member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. Five transcript variants that encode different isoforms have been found for the NXF5 gene.
  • Cellular localization

    Cytoplasmic and Nuclear. Mainly localized in the cytoplasm particularly in the cell body and neurites of hippocampal neurons. Nuclear localization is also observed. Not detected at nuclear rim.

Images

  • ab163295 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163295 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163295.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up