Overview

  • Product name

    Recombinant Human NY-REN-50 antigen protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MKVEKDHLAKPFFPAIYKEFEELHKLVKKMCQDYLSSSGLCSQETLEINN DKVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGEQLEGASSEKREREAA EEGLASVKRPRREALSNDTTESLAANSRGREKPRPLHALAAGEGFSPPVN VTVSPRSEESHTTTVSGGNGSVFQAGPQLQALANLEARRGSIGAALSSRD VSGLPVYAQSGEPRRLTQAQVAAFPGENALEHSSDQDTWDSLRSPGFCSP LSSGGGAESLPPGGPGHAEAGHLGKVCDFHLNHQQPSPTSVLPTEVAAPP LEKILSVDSVAVDCAYRTVPKPGPQPGPHGSLLTEGCLRSLSGDLNRFPC GMEVHSGQRELESVVAVGEAMAFEISNGSHELLSQGQKQIFIQTSDGLIL SPPGTIVSQEEDIVTVTDAEGRACGWAR
    • Amino acids

      1 to 428
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163215 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C14orf131
    • C14orf131 protein
    • Chromosome 14 open reading frame 131
    • FLJ11132
    • Hypothetical protein LOC55778
    • Renal carcinoma antigen NY-REN-50
    • Zinc finger protein 839
    • Zinc finger protein C14orf131
    • ZN839_HUMAN
    • ZNF839
    see all
  • Sequence similarities

    Contains 1 C2H2-type zinc finger.
  • Information by UniProt

Images

  • ab163215 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163215 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163215.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up