Recombinant Human OAZ3 protein (ab162635)

Description

  • Product name

    Recombinant Human OAZ3 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTVPWRPGKRRITYKEEEDLTLQPRPASSAPESLVGLQEGKSTEQGNHDQ LKELYSAGNLTVLATDPLLHQDPVQLDFHFRLTSQTSAHWHGLLCDRRLF LDIPYQALDQGNRESLTATLEYVEEKTNVDSVFVNFQNDRNDRGALLRAF SYMGFEVVRPDHPALPPLDNVIFMVYPLERDVGHLPSEPP
    • Amino acids

      1 to 190
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162635 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Antizyme 3
    • AZ3
    • OAZ t
    • OAZ3
    • OAZ3_HUMAN
    • ODC-Az 3
    • Ornithine decarboxylase antizyme 3
    • RP11-98D18.13-004
    • Testicular secretory protein Li 31
    • TISP15
    see all
  • Function

    Binds to, and destabilizes, ornithine decarboxylase. Does not accelerate ornithine decarboxylase degeneration. OAZ3 probably plays a key role in spermatogenesis by regulating the intracellular concentration of polyamines in haploid germ cells.
  • Tissue specificity

    Testis specific.
  • Sequence similarities

    Belongs to the ODC antizyme family.
  • Developmental stage

    Expression starts early in spermiogenesis and finishes in the late spermatid phase.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • ab162635 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162635 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162635.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up