Description

  • Product name

    Recombinant Human Occludin protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPED EILHFYKWTSPPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGG SVGYPYGGSGFGSYGSGYGYGYGYGYGYGGYTDPRAAKGFMLAMAAFCFI AALVIFVTSVIRSEMSRTRRYYLSVIIVSAILGIMVFIATIVYIMGVNPT AQSSGSLYGSQIYALCNQFYTPAATGLYVDQYSYHYCVVDPQEAIAIVLG FMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN VSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEV VQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYET DYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSEL DEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHC KQLKSKLSHIKKMVGDYDRQKT
    • Predicted molecular weight

      84 kDa including tags
    • Amino acids

      1 to 522
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114189 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names

    • BLCPMG
    • FLJ08163
    • FLJ18079
    • FLJ77961
    • FLJ94056
    • MGC34277
    • Occludin
    • Ocln
    • OCLN_HUMAN
    • Phosphatase 1 regulatory subunit 115
    • PPP1R115
    • PTORCH1
    • Tight junction protein occludin
    see all
  • Function

    May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. It is able to induce adhesion when expressed in cells lacking tight junctions.
  • Tissue specificity

    Localized at tight junctions of both epithelial and endothelial cells. Highly expressed in kidney. Not detected in testis.
  • Involvement in disease

    Defects in OCLN are the cause of band-like calcification with simplified gyration and polymicrogyria (BLCPMG) [MIM:251290]; also known as pseudo-TORCH syndrome. BLCPMG is a neurologic disorder with characteristic clinical and neuroradiologic features that mimic intrauterine TORCH infection in the absence of evidence of infection. Affected individuals have congenital microcephaly, intracranial calcifications, and severe developmental delay.
  • Sequence similarities

    Belongs to the ELL/occludin family.
    Contains 1 MARVEL domain.
  • Domain

    The C-terminal is cytoplasmic and is important for interaction with ZO-1. Sufficient for the tight junction localization. Involved in the regulation of the permeability barrier function of the tight junction (By similarity). The first extracellular loop participates in an adhesive interaction.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR. Dephosphorylated by PTPRJ. The tyrosine phosphorylation on Tyr-398 and Tyr-402 reduces its ability to interact with TJP1.
  • Cellular localization

    Membrane. Cell junction > tight junction.
  • Information by UniProt

Images

  • ab114189 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

This product has been referenced in:

  • Liu J  et al. Secreted Giardia intestinalis cysteine proteases disrupt intestinal epithelial cell junctional complexes and degrade chemokines. Virulence 9:879-894 (2018). Read more (PubMed: 29726306) »
See 1 Publication for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Answer

Thank you for your reply. I have processed your request to receive a new vial of ab114189 Occludin protein. At the moment the protein is out of stock and we will shop it to you as soon as it we can. Unfortunately, we do not have a estimated delivery date, but we will keep you posted when we get any new information. Your new order number is **********. If there is anything else I can help you with, please let me know.

Read More

Answer

Thank you for your patience while the lab was redoing the QC testing on ab114189. I just got the result from the QC department, please see the attachment, which has a copy of the western blot.As you could see, we used the anti-OCLN antibody and anti-GST antibody in WB for the OCLN recombinant protein. Both of them could pick up a single band at 83KDa.We also re-quantified the concentration of the protein, and it is just the same as the description on the label, 0.1ug/uL. Since the original product you purchased had degraded when you went to use it, I would be happy to send you a replacement vial of the protein if you wish, or I can process a refund. I look forward to your reply and resolving this issue for you.

Read More

Answer

Thank you for contacting Abcam. I am sorry that you were having problems with ab114189, Occludin protein. I have asked the lab to redo the quality control on this product and see if there is a problem with the current whole batch of the protein, or if the problem was with the vial that was sent to you. The QC testing will take a few days to complete and so, if you would like to receive a new vial of this product then I can either send it now or we can wait for the test results. The alternative is that I can process a full refund for the original product. I look forward to your reply and helping you resolve this issue.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up