Recombinant Human Occludin protein (ab114189)

Submit a review Q&A (3)References (1)
SDS-PAGE - Recombinant Human Occludin protein (ab114189)

    Key features and details

    • Expression system: Wheat germ
    • Tags: GST tag N-Terminus
    • Suitable for: SDS-PAGE, WB, ELISA

    Description

    • Product name

      Recombinant Human Occludin protein

    • Expression system

      Wheat germ

    • Accession

      Q16625

    • Protein length

      Full length protein

    • Animal free

      No

    • Nature

      Recombinant

      • Species

        Human

      • Sequence

        MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPED EILHFYKWTSPPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGG SVGYPYGGSGFGSYGSGYGYGYGYGYGYGGYTDPRAAKGFMLAMAAFCFI AALVIFVTSVIRSEMSRTRRYYLSVIIVSAILGIMVFIATIVYIMGVNPT AQSSGSLYGSQIYALCNQFYTPAATGLYVDQYSYHYCVVDPQEAIAIVLG FMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN VSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEV VQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYET DYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSEL DEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHC KQLKSKLSHIKKMVGDYDRQKT

      • Predicted molecular weight

        84 kDa including tags

      • Amino acids

        1 to 522

      • Tags

        GST tag N-Terminus

    Associated products

    Specifications

    Our Abpromise guarantee covers the use of ab114189 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

      Western blot

      ELISA

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.79% Tris HCl, 0.3% Glutathione

    General Info

    • Alternative names

      • BLCPMG
      • FLJ08163
      • FLJ18079
      • FLJ77961
      • FLJ94056
      • MGC34277
      • Occludin
      • Ocln
      • OCLN_HUMAN
      • Phosphatase 1 regulatory subunit 115
      • PPP1R115
      • PTORCH1
      • Tight junction protein occludin
      see all

    • Function

      May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. It is able to induce adhesion when expressed in cells lacking tight junctions.

    • Tissue specificity

      Localized at tight junctions of both epithelial and endothelial cells. Highly expressed in kidney. Not detected in testis.

    • Involvement in disease

      Defects in OCLN are the cause of band-like calcification with simplified gyration and polymicrogyria (BLCPMG) [MIM:251290]; also known as pseudo-TORCH syndrome. BLCPMG is a neurologic disorder with characteristic clinical and neuroradiologic features that mimic intrauterine TORCH infection in the absence of evidence of infection. Affected individuals have congenital microcephaly, intracranial calcifications, and severe developmental delay.

    • Sequence similarities

      Belongs to the ELL/occludin family.
      Contains 1 MARVEL domain.

    • Domain

      The C-terminal is cytoplasmic and is important for interaction with ZO-1. Sufficient for the tight junction localization. Involved in the regulation of the permeability barrier function of the tight junction (By similarity). The first extracellular loop participates in an adhesive interaction.

    • Post-translational
      modifications

      Phosphorylated upon DNA damage, probably by ATM or ATR. Dephosphorylated by PTPRJ. The tyrosine phosphorylation on Tyr-398 and Tyr-402 reduces its ability to interact with TJP1.

    • Cellular localization

      Membrane. Cell junction > tight junction.
    • Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human Occludin protein (ab114189)
      SDS-PAGE - Recombinant Human Occludin protein (ab114189)
      ab114189 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (1)

    Publishing research using ab114189? Please let us know so that we can cite the reference in this datasheet.

    ab114189 has been referenced in 1 publication.

    • Liu J  et al. Secreted Giardia intestinalis cysteine proteases disrupt intestinal epithelial cell junctional complexes and degrade chemokines. Virulence 9:879-894 (2018). PubMed: 29726306

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a question

    1-3 of 3 Q&A

    Question

    Thanks you for your reply and analysis. We would like to get a new vial of occludin. What info do you need from us to send us a replacement vial?

    Read More
    Answer

    Thank you for your reply. I have processed your request to receive a new vial of ab114189 Occludin protein. At the moment the protein is out of stock and we will shop it to you as soon as it we can. Unfortunately, we do not have a estimated delivery date, but we will keep you posted when we get any new information. Your new order number is **********. If there is anything else I can help you with, please let me know.

    Read More

    Question

      We recently purchased your recombinant Occludin protein (ab114189) protein. The Cooomassie stained SDS gel provided on the product sheet shows a fairly pure form of the protein. However, when we ran the preparation on SDS page followed by western blotting using a highly specific mouse anti-occludin antibody (Invitrogen 33-1500) that always just recognized a single specific bands in cell extracts we were surprised by the result (see attached PDF). The preparation appears to be highly impure and unusable. We would like to run a Commassie gel but since the concentration of your preparation is so low we did not not want to waste so much material given high price of this product. The specific lot number is 1000 420-27. We would like to request a proof of quality of this lot. Also, we request either a pure replacement preparation or a full refund (invoice enclosed).   We would appreciate a prompt reply in this manner.  

    Read More
    Answer

    Thank you for your patience while the lab was redoing the QC testing on ab114189. I just got the result from the QC department, please see the attachment, which has a copy of the western blot.As you could see, we used the anti-OCLN antibody and anti-GST antibody in WB for the OCLN recombinant protein. Both of them could pick up a single band at 83KDa.We also re-quantified the concentration of the protein, and it is just the same as the description on the label, 0.1ug/uL. Since the original product you purchased had degraded when you went to use it, I would be happy to send you a replacement vial of the protein if you wish, or I can process a refund. I look forward to your reply and resolving this issue for you.

    Read More

    Question

    Dear Sir/Madam,   We recently purchased your recombinant Occludin protein (ab114189) protein. The Cooomassie stained SDS gel provided on the product sheet shows a fairly pure form of the protein. However, when we ran the preparation on SDS page followed by western blotting using a highly specific mouse anti-occludin antibody (Invitrogen 33-1500) that always just recognized a single specific bands in cell extracts we were surprised by the result (see attached PDF). The preparation appears to be highly impure and unusable. We would like to run a Commassie gel but since the concentration of your preparation is so low we did not not want to waste so much material given high price of this product. The specific lot number is . We would like to request a proof of quality of this lot. Also, we request either a pure replacement preparation or a full refund (invoice enclosed).   We would appreciate a prompt reply in this manner.  

    Read More
    Answer

    Thank you for contacting Abcam. I am sorry that you were having problems with ab114189, Occludin protein. I have asked the lab to redo the quality control on this product and see if there is a problem with the current whole batch of the protein, or if the problem was with the vial that was sent to you. The QC testing will take a few days to complete and so, if you would like to receive a new vial of this product then I can either send it now or we can wait for the test results. The alternative is that I can process a full refund for the original product. I look forward to your reply and helping you resolve this issue.

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com