Overview

  • Product name

    Recombinant Human OCIAD1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPL AATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQE KFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAA DNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYE ELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE
    • Molecular weight

      54 kDa including tags
    • Amino acids

      1 to 245

Specifications

Our Abpromise guarantee covers the use of ab132720 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Asrij
    • FLJ20455
    • MGC111072
    • OCAD1_HUMAN
    • OCIA
    • OCIA domain containing 1
    • OCIA domain-containing protein 1
    • OCIAD1
    • Ovarian carcinoma immunoreactive antigen
    • TPA018
    see all
  • Tissue specificity

    Isoform 1 is highly expressed in many tissues, including testis, brain, placenta, ovary, prostate and mammary gland. Isoform 2 expression is restricted to the central nervous system including brain, cerebellum and spinal cord.
  • Sequence similarities

    Belongs to the OCIAD1 family.
    Contains 1 OCIA domain.
  • Cellular localization

    Endosome.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132720 stained with Coomassie Blue.

References

ab132720 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132720.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up