Description

  • Product name

    Recombinant Human Oct-1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNNPSETSKPSMESGDGNTGTQTNGLDFQKRPVPVGGAISTAQAQAFLGH LHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQT QLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQHSASQQHSAAG ATISASAATPMTQIPLSQPIQIAQDLQQLQQLQQQNLNLQQFVLVHPTTN LQPAQFIISQTPQGQQGLLQAQNLLTQLPQQSQANLLQSQPSITLTSQPA TPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRI KLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWL NDAENLSSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLE NQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRINPPSSGGTSSSPI KAIFPSPTSLVATTPSLVTSSAATTLTVSPVLPLTSAAVTNLSVTGTSDT TSNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSASETSTTQTTS TPLSSPLGTSQVMVTASGLQTAAAAALQGAAQLPANASLAAVAAAAGLNP SLMAPSQFAAGGALPSLNPGTLSGALSPALMSNSTLATIQALASGGSLPI TSLDATGNLVFANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASA GNSAPVASLHATSTSAESIQNSLFTVASASGAASTTTTASKAQ
    • Predicted molecular weight

      107 kDa including tags
    • Amino acids

      1 to 743

Specifications

Our Abpromise guarantee covers the use of ab152623 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ42836
    • NF A1
    • NF-A1
    • Oct 1
    • Oct 1B
    • Oct-1
    • OCT1
    • Octamer binding protein 1
    • Octamer binding transcription factor 1
    • Octamer-binding protein 1
    • Octamer-binding transcription factor 1
    • OTF 1
    • OTF-1
    • OTF1
    • OTTHUMP00000032348
    • OTTHUMP00000032350
    • OTTHUMP00000032351
    • PO21
    • PO2F1
    • PO2F1_HUMAN
    • POU class 2 homeobox 1
    • POU domain class 2 transcription factor 1
    • POU domain, class 2, transcription factor 1
    • POU2F1
    see all
  • Function

    Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3') and activates the promoters of the genes for some small nuclear RNAs (snRNA) and of genes such as those for histone H2B and immunoglobulins. Modulates transcription transactivation by NR3C1, AR and PGR (By similarity). In case of human herpes simplex virus (HSV) infection, POU2F1 forms a multiprotein-DNA complex with the viral transactivator protein VP16 and HCFC1 thereby enabling the transcription of the viral immediate early genes.
  • Tissue specificity

    Ubiquitous. Isoform 2 is lymphocyte-specific.
  • Sequence similarities

    Belongs to the POU transcription factor family. Class-2 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Post-translational
    modifications

    Phosphorylated by PRKDC.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152623 stained with Coomassie Blue.

References

ab152623 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152623.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up