Recombinant human Oct4 protein (ab169842)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human Oct4 protein
See all Oct4 proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPG VGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAG VGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFA KLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKL RPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFL QCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA AGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV TTLGSPMHSNESGGGGSPGRRRRRRRRRRR -
Predicted molecular weight
41 kDa -
Amino acids
1 to 360
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab169842 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Liquid -
Additional notes
The in vitro function was tested using specific DNA binding assays. 11R proteins were reported to successfully generate induced pluripotent stem (iPS) cells from OG2 MEFs.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
pH: 7.50
Constituents: Calcium chloride, Potassium chloride, Magnesium chloride, 0.24% Tris, Glycerol, Sodium chloride
Also contains DTT and Arginine.This product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- Octamer binding transcription factor 4
- MGC22487
- Oct 3
see all -
Function
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency. -
Tissue specificity
Expressed in developing brain. Highest levels found in specific cell layers of the cortex, the olfactory bulb, the hippocampus and the cerebellum. Low levels of expression in adult tissues. -
Sequence similarities
Belongs to the POU transcription factor family. Class-5 subfamily.
Contains 1 homeobox DNA-binding domain.
Contains 1 POU-specific domain. -
Developmental stage
Highly expressed in undifferentiated embryonic stem cells and expression decreases gradually after embryoid body (EB) formation. -
Domain
The POU-specific domain mediates interaction with PKM2. -
Post-translational
modificationsSumoylation enhances the protein stability, DNA binding and transactivation activity. Sumoylation is required for enhanced YES1 expression.
Ubiquitinated; undergoes 'Lys-63'-linked polyubiquitination by WWP2 leading to proteasomal degradation. -
Cellular localization
Nucleus. Expressed in a diffuse and slightly punctuate pattern. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (2)
ab169842 has been referenced in 2 publications.
- Vanzan L et al. High throughput screening identifies SOX2 as a super pioneer factor that inhibits DNA methylation maintenance at its binding sites. Nat Commun 12:3337 (2021). PubMed: 34099689
- AlAbdi L et al. Oct4-Mediated Inhibition of Lsd1 Activity Promotes the Active and Primed State of Pluripotency Enhancers. Cell Rep 30:1478-1490.e6 (2020). PubMed: 32023463