Recombinant Human Ocular development associated gene protein (ab163651)

Description

  • Product name

    Recombinant Human Ocular development associated gene protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGRGGAGSGGAGSGAAG GTGGSGGGGFGAATFASTSATPPQSNGGGGGKQSKQEIHRRSARLRNTKY KSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAESIFYKGVYYQ IGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIPTLSSPRDQFD PASYIIGPEEDLPRKMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIW THVGPTPAITIKESVANHL
    • Amino acids

      1 to 269
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2310031E19Rik
    • 2810047M21Rik
    • 8430439A17Rik
    • 9130430G15Rik
    • B330017N08Rik
    • ENSMUSG00000073241
    • FLJ22489
    • FLJ40695
    • GATA zinc finger domain containing 1
    • GATAD1 protein
    • ocular development associated
    • ODAG
    • RG083M05.2
    • tcag7.279
    see all
  • Relevance

    ODAG (Ocular development-associated gene), a novel transcription factor located on chromosome 7, encodes a protein that may play a role in eye development. mRNA profiling in multiple human tissue indicates that ODAG is expressed in human CD56+ NK cells and thyroid tissue.
  • Cellular localization

    Nuclear

Images

  • ab163651 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163651 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up