Overview

  • Product name

    Recombinant Human OGT / O-Linked N-Acetylglucosamine Transferase protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQ EPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYK ERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSAL QYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCV FNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLR ALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLA NALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLY RKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSN MGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIA SYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKN RLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLK LSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTN FRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNEL FALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMP HTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPD VKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITIN GFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQL YKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRI IFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGET LASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQ RISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA
    • Molecular weight

      143 kDa including tags
    • Amino acids

      1 to 1046

Specifications

Our Abpromise guarantee covers the use of ab131881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ23071
    • GlcNAc transferase
    • HRNT1
    • MGC22921
    • O GlcNAc
    • O GlcNAc transferase p110 subunit
    • O GlcNAc transferase subunit p110
    • O linked N acetylglucosamine (GlcNAc) transferase
    • O linked N acetylglucosamine (GlcNAc) transferase (UDP N acetylglucosamine:polypeptide N acetylglucosaminyl transferase)
    • O linked N acetylglucosamine transferase 110 kDa subunit
    • O-GlcNAc transferase subunit p110
    • O-linked N-acetylglucosamine transferase 110 kDa subunit
    • ogt
    • OGT1_HUMAN
    • UDP N acetylglucosamine peptide N acetylglucosaminyltransferase 110 kDa subunit
    • UDP N acetylglucosamine peptide N acetylglucosaminyltransferase GlcNAc transferase
    • UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
    • UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase
    • Uridinediphospho N acetylglucosamine:polypeptide beta N acetylglucosaminyl transferase
    see all
  • Function

    Addition of nucleotide-activated sugars directly onto the polypeptide through O-glycosidic linkage with the hydroxyl of serine or threonine. Mediates the O-glycosylation of MLL5 and HCFC1. Promotes proteolytic maturation of HCFC1.
  • Tissue specificity

    Highly expressed in pancreas and to a lesser extent in skeletal muscle, heart, brain and placenta. Present in trace amounts in lung and liver.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the O-GlcNAc transferase family.
    Contains 13 TPR repeats.
  • Domain

    The TPR repeat domain mediates recognition of protein substrates.
  • Post-translational
    modifications

    Ubiquitinated, leading to its proteasomal degradation.
  • Cellular localization

    Cytoplasm. Nucleus. Mostly in the nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab131881 at approximately 143.3 kDa.

References

ab131881 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131881.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up