Description

  • Product name

    Recombinant Human OLFM4 protein (His tag)
    See all OLFM4 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DLGDVGPPIPSPGFSSFPGVDSSSSFSSSSRSGSSSSRSLGSGGSVSQLF SNFTGSVDDRGTCQCSVSLPDTTFPVDRVERLEFTAHVLSQKFEKELSKV REYVQLISVYEKKLLNLTVRIDIMEKDTISYTELDFELIKVEVKEMEKLV IQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALK TKLKECEASKDQNTPVVHPPPTPGSCGHGGVVNISKPSVVQLNWRGFSYL YGAWGRDYSPQHPNKGLYWVAPLNTDGRLLEYYRLYNTLDDLLLYINARE LRITYGQGSGTAVYNNNMYVNMYNTGNIARVNLTTNTIAVTQTLPNAAYN NRFSYANVAWQDIDFAVDENGLWVIYSTEASTGNMVISKLNDTTLQVLNT WYTKQYKPSASNAFMVCGVLYATRTMNTRTEEIFYYYDTNTGKEGKLDIV MHKMQEKVQSINYNPFDQKLYVYNDGYLLNYDLSVLQKPQGGGGSHHHHH HHHHH
    • Predicted molecular weight

      57 kDa including tags
    • Amino acids

      21 to 510
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Corresponding to full length mature protein without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab215595 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term.

    pH: 7.4
    Constituent: 100% PBS

    Lyophilized from a 0.2 µm filtered solution

  • Reconstitution
    Reconstitute with ddH2O to a concentration no less than 100 µg/mL. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • Antiapoptotic protein GW112
    • bA209J19.1
    • G-CSF-stimulated clone 1 protein
    • GC1
    • GW112
    • hGC 1
    • hGC-1
    • hOLfD
    • KIAA4294
    • olfactomedin 4
    • Olfactomedin-4
    • OlfD
    • OLFM4
    • OLFM4_HUMAN
    • OLM4
    • UNQ362
    see all
  • Function

    An antiapoptotic factor that promotes tumor growth. Promotes proliferation of pancreatic cancer cells by favoring the transition from the S to G2/M phase. Facilitates cell adhesion.
  • Tissue specificity

    Expressed during myeloid lineage development. Strongly expressed in the prostate, small intestine and colon and moderately expressed in the bone marrow and stomach. Highly expressed in pancreatic cancer tissues and shows an elevated expression level during the early S phase of the cell cycle. Also expressed at high levels in stomach cancer and colon cancer tissues.
  • Sequence similarities

    Contains 1 olfactomedin-like domain.
  • Domain

    The olfactomedin-like domain is involved in the interaction with cadherin.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Secreted > extracellular space. According to PubMed:15059901, found in mitochondrion and nucleus.
  • Information by UniProt

References

ab215595 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215595.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up