Description

  • Product name

    Recombinant Human Oligodendrocyte myelin glycoprotein
    See all Oligodendrocyte myelin glycoprotein proteins and peptides
  • Purity

    > 92 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDLHNQL TQYTNLRTLD ISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQ WNLKYLDVSKNMLEKVVLIKNT LRSLEVLNLSSNKLWTVPTNMPSKLH IVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFT FIPDQSFDQLFQLQ EITLYNNRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEH NM YPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGA TLSKDTTF TSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTN TSLTSSTKSSPTPMTLSITS GMPNNFSEMPQQSTTLNLWREETTTNVK TPLPSVAN
    • Predicted molecular weight

      46 kDa including tags
    • Amino acids

      25 to 420
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Full length mature protein without signal peptide or propeptide.

Specifications

Our Abpromise guarantee covers the use of ab191643 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 95% PBS, 5% Trehalose

  • Reconstitution
    Reconstitute the lyophilized product in 1000 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Oligodendrocyte-myelin glycoprotein
    • Omg
    • OMGP
    • OMGP_HUMAN
  • Function

    Cell adhesion molecule contributing to the interactive process required for myelination in the central nervous system.
  • Tissue specificity

    Oligodendrocytes and myelin of the central nervous system.
  • Sequence similarities

    Contains 8 LRR (leucine-rich) repeats.
    Contains 1 LRRNT domain.
  • Post-translational
    modifications

    O-glycosylated in its Ser/Thr-rich repeat domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • DTT-reduced (+) SDS-PAGE with ab191643 and staining overnight with Coomassie Blue. DTT-reduced protein migrates as 90-120 kDa due to glycosylation.

References

ab191643 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191643.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up