Recombinant Human Oligodendrocyte myelin glycoprotein (His tag) (ab219462)

Description

  • Product name

    Recombinant Human Oligodendrocyte myelin glycoprotein (His tag)
    See all Oligodendrocyte myelin glycoprotein proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab219462 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ICPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHLNLSYNHFTDLHNQL TQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWN LKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDL SNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYN NRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFT SSLFTVSGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTF TSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSS PTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVEHHHHH H
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      25 to 418
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 25 to 418. The signal peptide and propeptide are not included (NP_002535).

Specifications

Our Abpromise guarantee covers the use of ab219462 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • Oligodendrocyte-myelin glycoprotein
    • Omg
    • OMGP
    • OMGP_HUMAN
  • Function

    Cell adhesion molecule contributing to the interactive process required for myelination in the central nervous system.
  • Tissue specificity

    Oligodendrocytes and myelin of the central nervous system.
  • Sequence similarities

    Contains 8 LRR (leucine-rich) repeats.
    Contains 1 LRRNT domain.
  • Post-translational
    modifications

    O-glycosylated in its Ser/Thr-rich repeat domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 μg ab219462.

    Molecular Weight: 50-100 kDa (SDS–PAGE under reducing conditions).

References

ab219462 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219462.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up