Overview

  • Product name

    Recombinant Human Oligodendrocyte Specific Protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSK GLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLL TVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIWFPVCAHRETT IVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPT HAKSAHV
    • Molecular weight

      48 kDa including tags
    • Amino acids

      1 to 207

Specifications

Our Abpromise guarantee covers the use of ab131748 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    O75508
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Claudin 11
    • Claudin-11
    • CLD11_HUMAN
    • Cldn11
    • Oligodendrocyte transmembrane protein
    • Oligodendrocyte-specific protein
    • OSP
    • OTM
    see all
  • Function

    Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
  • Sequence similarities

    Belongs to the claudin family.
  • Cellular localization

    Cell junction > tight junction. Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131748, stained with Coomassie Blue.

References

ab131748 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131748.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up