Description

  • Product name

    Recombinant human OMA1 protein (Active)
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized ab235020 at 5 μg/ml can bind human BZW2, the EC50 of human BZM2 is 45.42-72.22 μg/ml.

  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Cell free
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      HVFFRFNSLSNWRKCNTLASTSRGCHQVQVNHIVNKYQGLGVNQCDRWSF LPGNFHFYSTFNNKRTGGLSSTKSKEIWRITSKCTVWNDAFSRQLLIKEV TAVPSLSVLHPLSPASIRAIRNFHTSPRFQAAPVPLLLMILKPVQKLFAI IVGRGIRKWWQALPPNKKEVVKENIRKNKWKLFLGLSSFGLLFVVFYFTH LEVSPITGRSKLLLLGKEQFRLLSELEYEAWMEEFKNDMLTEKDARYLAV KEVLCHLIECNKDVPGISQINWVIHVVDSPIINAFVLPNGQMFVFTGFLN SVTDIHQLSFLLGHEIAHAVLGHAAEKAGMVHLLDFLGMIFLTMIWAICP RDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRAS SVFWQQMEFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMC NCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIP LTYIVEKRTGS
    • Predicted molecular weight

      75 kDa including tags
    • Amino acids

      14 to 524
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full length mature chain without transit peptide. N-terminal 6xHis-SUMO-tagged. In vitro E.coli expression system .

Specifications

Our Abpromise guarantee covers the use of ab235020 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 2010001O09Rik
    • DAB1
    • FLJ33782
    • Metalloendopeptidase OMA1
    • Metalloendopeptidase OMA1, mitochondrial
    • Metalloprotease-related protein 1
    • mitochondrial
    • MPRP 1
    • MPRP-1
    • MPRP1
    • OMA1
    • OMA1 homolog zinc metallopeptidase
    • OMA1 homolog, zinc metallopeptidase (S. cerevisiae)
    • OMA1 zinc metallopeptidase
    • OMA1 zinc metallopeptidase homolog
    • OMA1_HUMAN
    • Overlapping activity with M-AAA protease
    • Overlapping with the m-AAA protease 1 homolog
    • peptidase
    • YKR087C
    • Zinc metallopeptidase OMA1
    • ZMPOMA1
    see all
  • Function

    Mitochondrial protease.
  • Tissue specificity

    Widely expressed, with strong expression in the heart, skeletal muscle, kidney and liver.
  • Sequence similarities

    Belongs to the peptidase M48 family.
  • Cellular localization

    Mitochondrion membrane.
  • Information by UniProt

Images

  • The binding activity of ab235020 with BZW2.

  • ab235020 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235020 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235020.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up