Description

  • Product name

    Recombinant Human OP-2 protein (denatured)
    See all OP-2 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSAVRPLRRRQPKKSNELPQANRLPGIFD DVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDS CMNATNHAILQSLVHLMMPDAVPKACCAPTKLSATSVLYYDSSNNVILRK HRNMVVKACGCH
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      264 to 402
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature protein; NP_001711.

Specifications

Our Abpromise guarantee covers the use of ab180273 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein previously labeled as BMP8b.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names

    • BMP-8
    • BMP-8B
    • BMP8
    • Bmp8b
    • BMP8B_HUMAN
    • Bone morphogenetic protein 8
    • bone morphogenetic protein 8 (osteogenic protein 2)
    • Bone morphogenetic protein 8B
    • dJ118J21.1 (bone morphogenetic protein 8 (osteogenic protein 2))
    • OP-2
    • OP2
    • Osteogenic protein 2
    see all
  • Function

    Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180273 (3μg).

References

ab180273 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180273.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up