Description

  • Product name

    Recombinant Human Opticin protein (denatured)
  • Purity

    > 85 % SDS-PAGE.
    ab202160 was purified by conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSASLPRKERKRREEQMPREGDSFEVLPL RNDVLNPDNYGEVIDLSNYEELTDYGDQLPEVKVTSLAPATSISPAKSTT APGTPSSNPTMTRPTTAGLLLSSQPNHGLPTCLVCVCLGSSVYCDDIDLE DIPPLPRRTAYLYARFNRISRIRAEDFKGLTKLKRIDLSNNLISSIDNDA FRLLHALQDLILPENQLEALPVLPSGIEFLDVRLNRLQSSGIQPAAFRAM EKLQFLYLSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKH TRRQLEDIRLDGNPINLSLFPSAYFCLPRLPIGRFT
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      20 to 332
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature protein without signal peptide. NP_055174.
  • Description

    Recombinant Human Opticin protein

Specifications

Our Abpromise guarantee covers the use of ab202160 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Oculoglycan
    • OPT
    • OPT_HUMAN
    • OPTC
    • Opticin
    see all
  • Function

    Binds collagen fibrils.
  • Tissue specificity

    Retina, iris, ligament, skin and fetal liver.
  • Sequence similarities

    Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class III subfamily.
    Contains 6 LRR (leucine-rich) repeats.
    Contains 1 LRRNT domain.
  • Post-translational
    modifications

    O-glycosylated.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202160 (3µg).

References

ab202160 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202160.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up