Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MQATSNLLNLLLLSLFAGLDPSKTQISPKEGWQVYSSAQDPDGRCICTVV APEQNLCSRDAKSRQLRKLLEKVQNMSQSIEVLNLRTQRDFQYVLKMETQ MKGLKAKFRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLI TQFKEEIRNLSAVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCG KLMKITGPVTVKTSGTRFGAWMTDPLASEKNNRVWYMDSYTNNKIVREYK SIADFVSGAESRTYNLPFKWAGTNHVVYNGSLYFNKYQSNIIIKYSFDMG RVLAQRSLEYAGFHNVYPYTWGGFSDIDLMADEIGLWAVYATNQNAGNIV ISQLNQDTLEVMKSWSTGYPKRSAGESFMICGTLYVTNSHLTGAKVYYSY STKTSTYEYTDIPFHNQYFHISMLDYNARDRALCAWNNGHQVLFNVTLFH IIKTEDDT
    • Molecular weight

      79 kDa including tags
    • Amino acids

      1 to 458

Specifications

Our Abpromise guarantee covers the use of ab132410 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Noe3
    • NOE3_HUMAN
    • Noelin 3
    • Noelin-3
    • NOELIN3
    • NOELIN3 V1
    • NOELIN3 V2
    • NOELIN3 V3
    • NOELIN3 V4
    • NOELIN3 V5
    • NOELIN3 V6
    • Olfactomedin 3
    • Olfactomedin related ER localized protein 3
    • Olfactomedin-3
    • Olfactomedin3
    • Olfm3
    • Optimedin
    • OTTHUMP00000012614
    see all
  • Tissue specificity

    In the eye, expressed in trabecular meshwork and neural retina; in non-ocular tissues, expressed in brain and lung.
  • Sequence similarities

    Contains 1 olfactomedin-like domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132410, stained with Coomassie Blue.

References

ab132410 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132410.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up