Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAIC SDVRLHNPMYFLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQ MYFMIALGNTDSYILAAMAYDRAVAISRPLHYTTIMSPRSCIWLIAGSWV IGNANALPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFHVKMMY LGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTCGSHLTVVSLY YGTVMGTYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALR KLFNKRISS
    • Amino acids
      1 to 309
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160012 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Olfactory receptor 17 7
    • Olfactory receptor family 1 subfamily A member 1
    • Olfactory receptor OR17 11
    • OR17 7
  • Relevance
    OR1A1 belongs to the G protein coupled receptor 1 family and functions as an odorant receptor. Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G protein coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7 transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
  • Cellular localization
    Cell membrane; Multi pass membrane protein.

Images

  • ab160012 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160012 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160012.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up