Description

  • Product name

    Recombinant Human OR7G2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEARNQTAISKFLLLGLIEDPELQPVLFSLFLSMYLVTILGNLLILLAVI SDSHLHTPMYFFLSNLSFLDICLSTTTIPKMLVNIQAQNRSITYSGCLTQ ICFVLFFAGLENCLLAAMAYDRYVAICHPLRYTVIMNPRLCGLLILLSLL TSVVNALLLSLMVLRLSFCTDLEIPLFFCELAQVIQLTCSDTLINNILIY FAACIFGGVPLSGIILSYTQITSCVLRMPSASGKHKAVSTCGSHLSIVLL FYGAGLGVYISSVVTDSPRKTAVASVMYSVFPQMVNPFIYSLRNKDMKGT LRKFIGRIPSLLWCAICFGFRFLE
    • Amino acids

      1 to 324
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Olfactory receptor 19-13
    • Olfactory receptor 7G2
    • Olfactory receptor OR19-6
    • OR19-13
    • OR7G2
    • OR7G2_HUMAN
    • OST260
    see all
  • Function

    Odorant receptor.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab166466 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up